PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02796.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 302aa    MW: 33503.2 Da    PI: 9.9052
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02796.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-3860118462
                   zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              ++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss
  Rsa1.0_02796.1_g00003.1  60 EKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 118
                              789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2957116IPR003851Zinc finger, Dof-type
PfamPF027014.8E-3361116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.70562116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MINVKPIEQI ISNNTSQQQL QTFIATTERP NHTASKSGSG ARNDNNTATT MESRKARPLE  60
KVNCPRCNST NTKFCYYNNY SLTQPRYFCK GCRRYWTEGG SLRNVPVGGS SRKNKRSSTP  120
LASRSNPKLP DLNPPFLFAS QIPNKSSKDL NLLSFPVMQD HHHGMSQLLH MPKIENNNTS  180
SSIYASSSPG ASSRGMNMFL PGQMMDSNSV LYSSLGLPTL MADYKLSNNN LSFSTDHHQG  240
IGHNTINNNQ RAEDNNHAGD MNGASRVLFP FSDTKELSST NQEKSHNTYW SGMFSNTGGS  300
SW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794810.0JN979481.1 Brassica rapa subsp. pekinensis auxin response factor 18-1 (ARF18-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741905.10.0PREDICTED: dof zinc finger protein DOF3.7-like isoform X1
RefseqXP_013741907.10.0PREDICTED: dof zinc finger protein DOF3.7-like isoform X1
SwissprotQ433851e-159DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A078DC190.0A0A078DC19_BRANA; BnaA09g21650D protein
TrEMBLA0A078JGP60.0A0A078JGP6_BRANA; BnaCnng44400D protein
STRINGBra014418.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.41e-164Dof family protein